Lineage for d2ogya_ (2ogy A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 974814Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 974839Family c.1.21.2: Methyltetrahydrofolate-utiluzing methyltransferases [51723] (3 proteins)
  6. 974862Protein automated matches [190620] (2 species)
    not a true protein
  7. 974867Species Moorella thermoacetica [TaxId:1525] [187652] (2 PDB entries)
  8. 974870Domain d2ogya_: 2ogy A: [166694]
    automated match to d1f6ya_
    complexed with c2f, ca; mutant

Details for d2ogya_

PDB Entry: 2ogy (more details), 2.3 Å

PDB Description: asn199ala mutant of the 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase complexed with methyltetrahydrofolate to 2.3 angstrom resolution
PDB Compounds: (A:) 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase

SCOPe Domain Sequences for d2ogya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ogya_ c.1.21.2 (A:) automated matches {Moorella thermoacetica [TaxId: 1525]}
mliigeringmfgdikraiqerdpapvqewarrqeeggaraldlnvgpavqdkvsamewl
vevtqevsnltlcldstnikaieaglkkcknraminstnaerekveklfplavehgaali
gltmnktgipkdsdtrlafamelvaaadefglpmedlyidplilpanvaqdhapevlktl
qqikmladpapktvlglsavsqncqnrplinrtflamamacgldaaiadacdealietaa
taeillnqtvycdsfvkmfktr

SCOPe Domain Coordinates for d2ogya_:

Click to download the PDB-style file with coordinates for d2ogya_.
(The format of our PDB-style files is described here.)

Timeline for d2ogya_: