SCOP 1.59: Domain d1bfrt_: 1bfr T:

Lineage for d1bfrt_ (1bfr T:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.25: Ferritin-like [47239] (1 superfamily)

4. Superfamily a.25.1: Ferritin-like [47240] (2 families)

5. Family a.25.1.1: Ferritin [47241] (5 proteins)

6. Protein Bacterioferritin (cytochrome b1) [47244] (2 species)

7. Species Escherichia coli [TaxId:562] [47245] (2 PDB entries)

8. Domain d1bfrt_: 1bfr T: [16669]

Details for d1bfrt_

PDB Entry: 1bfr, 2.94 Å

PDB Description: iron storage and electron transport

SCOP Domain Sequences for d1bfrt_:

Sequence; same for both SEQRES and ATOM records:

>d1bfrt_ a.25.1.1 (T:) Bacterioferritin (cytochrome b1) {Escherichia coli}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqireeg

Timeline for d1bfrt_:

• d1bfrt_ first appeared (with stable ids) in SCOP 1.55
  
• d1bfrt_ appears in SCOP 1.57
  
• d1bfrt_ appears in SCOP 1.61
  
• d1bfrt_ appears in the current release, SCOPe 2.08