SCOPe 2.01: Domain d2ofsa_: 2ofs A:

Lineage for d2ofsa_ (2ofs A:)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (7 proteins)

6. Protein automated matches [190308] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187126] (3 PDB entries)

8. Domain d2ofsa_: 2ofs A: [166684]
   automated match to d1cdqa_

Details for d2ofsa_

PDB Entry: 2ofs, 2.12 Å

PDB Description: crystal structure of human cd59

PDB Compounds: (A:) cd59 glycoprotein

SCOPe Domain Sequences for d2ofsa_:

Sequence; same for both SEQRES and ATOM records:

>d2ofsa_ g.7.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
flqcyncpnptadcktavqcssdfdaclitkaglqvynkcwkfehcnfndvttrlrenel
tyycckkdlcnfneq

Timeline for d2ofsa_:

• d2ofsa_ is new in SCOPe 2.01-stable
  
• d2ofsa_ appears in SCOPe 2.02
  
• d2ofsa_ appears in the current release, SCOPe 2.08, called d2ofsa1