SCOPe 2.08: Domain d2ofsa1: 2ofs A:1-74

Lineage for d2ofsa1 (2ofs A:1-74)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)

6. Protein CD59 [57355] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57356] (11 PDB entries)

8. Domain d2ofsa1: 2ofs A:1-74 [166684]
   Other proteins in same PDB: d2ofsa2
   automated match to d1cdqa_

Details for d2ofsa1

PDB Entry: 2ofs, 2.12 Å

PDB Description: crystal structure of human cd59

PDB Compounds: (A:) cd59 glycoprotein

SCOPe Domain Sequences for d2ofsa1:

Sequence; same for both SEQRES and ATOM records:

>d2ofsa1 g.7.1.3 (A:1-74) CD59 {Human (Homo sapiens) [TaxId: 9606]}
lqcyncpnptadcktavqcssdfdaclitkaglqvynkcwkfehcnfndvttrlrenelt
yycckkdlcnfneq

Timeline for d2ofsa1:

• d2ofsa1 first appeared in SCOPe 2.01, called d2ofsa_
  
• d2ofsa1 appears in SCOPe 2.07