SCOPe 2.07: Domain d2ofkb_: 2ofk B:

Lineage for d2ofkb_ (2ofk B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families)

5. Family a.96.1.4: 3-Methyladenine DNA glycosylase I (Tag) [74756] (1 protein)
   automatically mapped to Pfam PF03352

6. Protein 3-Methyladenine DNA glycosylase I (Tag) [74757] (2 species)

7. Species Salmonella typhi [TaxId:601] [187956] (2 PDB entries)

8. Domain d2ofkb_: 2ofk B: [166682]
   automated match to d1lmza_
   complexed with pge, zn

Details for d2ofkb_

PDB Entry: 2ofk, 1.5 Å

PDB Description: Crystal Structure of 3-methyladenine DNA glycosylase I (TAG)

PDB Compounds: (B:) 3-methyladenine DNA glycosylase I, constitutive

SCOPe Domain Sequences for d2ofkb_:

Sequence; same for both SEQRES and ATOM records:

>d2ofkb_ a.96.1.4 (B:) 3-Methyladenine DNA glycosylase I (Tag) {Salmonella typhi [TaxId: 601]}
mqrcdwvsqdplyiayhdnewgvpetdsrklfemiclegqqaglswitvlkkrenyracf
hqfdpiriaamqeedverllqntgiirhrgkiqaiisnarawlameqngesfadfvwsfv
dgqpqitqaasldkiptstpasdalakalkkrgfkfvgtticysfmqacglvndhitgcf
chp

Timeline for d2ofkb_:

• d2ofkb_ first appeared in SCOPe 2.01
  
• d2ofkb_ appears in SCOPe 2.06
  
• d2ofkb_ appears in the current release, SCOPe 2.08