| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.96: DNA-glycosylase [48149] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.96.1: DNA-glycosylase [48150] (7 families) ![]() |
| Family a.96.1.4: 3-Methyladenine DNA glycosylase I (Tag) [74756] (1 protein) automatically mapped to Pfam PF03352 |
| Protein 3-Methyladenine DNA glycosylase I (Tag) [74757] (2 species) |
| Species Salmonella typhi [TaxId:601] [187956] (2 PDB entries) |
| Domain d2ofkb_: 2ofk B: [166682] automated match to d1lmza_ complexed with pge, zn |
PDB Entry: 2ofk (more details), 1.5 Å
SCOPe Domain Sequences for d2ofkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ofkb_ a.96.1.4 (B:) 3-Methyladenine DNA glycosylase I (Tag) {Salmonella typhi [TaxId: 601]}
mqrcdwvsqdplyiayhdnewgvpetdsrklfemiclegqqaglswitvlkkrenyracf
hqfdpiriaamqeedverllqntgiirhrgkiqaiisnarawlameqngesfadfvwsfv
dgqpqitqaasldkiptstpasdalakalkkrgfkfvgtticysfmqacglvndhitgcf
chp
Timeline for d2ofkb_: