Lineage for d2ofia_ (2ofi A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2720979Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2720980Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2721102Family a.96.1.4: 3-Methyladenine DNA glycosylase I (Tag) [74756] (1 protein)
    automatically mapped to Pfam PF03352
  6. 2721103Protein 3-Methyladenine DNA glycosylase I (Tag) [74757] (2 species)
  7. 2721108Species Salmonella typhi [TaxId:601] [187956] (2 PDB entries)
  8. 2721111Domain d2ofia_: 2ofi A: [166680]
    automated match to d1lmza_
    protein/DNA complex; complexed with adk, na, zn

Details for d2ofia_

PDB Entry: 2ofi (more details), 1.85 Å

PDB Description: Crystal Structure of 3-methyladenine DNA Glycosylase I (TAG) bound to DNA/3mA
PDB Compounds: (A:) 3-methyladenine DNA glycosylase I, constitutive

SCOPe Domain Sequences for d2ofia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ofia_ a.96.1.4 (A:) 3-Methyladenine DNA glycosylase I (Tag) {Salmonella typhi [TaxId: 601]}
mqrcdwvsqdplyiayhdnewgvpetdsrklfemiclegqqaglswitvlkkrenyracf
hqfdpiriaamqeedverllqntgiirhrgkiqaiisnarawlameqngesfadfvwsfv
dgqpqitqaasldkiptstpasdalakalkkrgfkfvgtticysfmqacglvndhitgcf
chpg

SCOPe Domain Coordinates for d2ofia_:

Click to download the PDB-style file with coordinates for d2ofia_.
(The format of our PDB-style files is described here.)

Timeline for d2ofia_: