Lineage for d2ofeb_ (2ofe B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2408952Fold b.97: Cytolysin/lectin [63723] (1 superfamily)
    sandwich, 10 strands in 2 sheets;
  4. 2408953Superfamily b.97.1: Cytolysin/lectin [63724] (2 families) (S)
    some topological similarity to osmotin
  5. 2408975Family b.97.1.2: Fungal fruit body lectin [117119] (3 protein domains)
    Pfam PF07367
  6. 2408994Protein automated matches [190758] (3 species)
    not a true protein
  7. 2408995Species Athelia rolfsii [TaxId:39291] [187957] (7 PDB entries)
  8. 2408999Domain d2ofeb_: 2ofe B: [166679]
    automated match to d1y2ta_
    complexed with act, mpd, nag

Details for d2ofeb_

PDB Entry: 2ofe (more details), 1.7 Å

PDB Description: The Crystal structure of Sclerotium rolfsii lectin in complex with N-acetyl-D-glucosamine
PDB Compounds: (B:) Sclerotium rolfsii lectin

SCOPe Domain Sequences for d2ofeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ofeb_ b.97.1.2 (B:) automated matches {Athelia rolfsii [TaxId: 39291]}
tykitvrvyqtnpnaffhpvektvwkyanggtwtitddqhvltmggsgtsgtlrfhadng
esftatfgvhnykrwcdivtnlaadetgmvinqqyysqknreearerqlsnyevknakgr
nfeivyteaegndlhanliig

SCOPe Domain Coordinates for d2ofeb_:

Click to download the PDB-style file with coordinates for d2ofeb_.
(The format of our PDB-style files is described here.)

Timeline for d2ofeb_: