Lineage for d2ofbb_ (2ofb B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 958655Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 958656Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 958657Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 958955Protein automated matches [190191] (2 species)
    not a true protein
  7. 958956Species Chicken (Gallus gallus) [TaxId:9031] [186931] (19 PDB entries)
  8. 958964Domain d2ofbb_: 2ofb B: [166673]
    automated match to d1rava_
    complexed with bni, fmt

Details for d2ofbb_

PDB Entry: 2ofb (more details), 1.16 Å

PDB Description: crystal structure of avr4 (r112l/c122s)-bna complex
PDB Compounds: (B:) Avidin-related protein 4/5

SCOPe Domain Sequences for d2ofbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ofbb_ b.61.1.1 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
csltgkwtnnlgsimtiravnsrgeftgtyltavadnpgnitlspllgiqhkrasqptfg
ftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwkatlvgynnftrls

SCOPe Domain Coordinates for d2ofbb_:

Click to download the PDB-style file with coordinates for d2ofbb_.
(The format of our PDB-style files is described here.)

Timeline for d2ofbb_: