SCOPe 2.08: Domain d2ofbb1: 2ofb B:204-321

Lineage for d2ofbb1 (2ofb B:204-321)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [186931] (28 PDB entries)

8. Domain d2ofbb1: 2ofb B:204-321 [166673]
   Other proteins in same PDB: d2ofba2, d2ofbb2
   automated match to d1rava_
   complexed with bni, fmt

Details for d2ofbb1

PDB Entry: 2ofb, 1.16 Å

PDB Description: crystal structure of avr4 (r112l/c122s)-bna complex

PDB Compounds: (B:) Avidin-related protein 4/5

SCOPe Domain Sequences for d2ofbb1:

Sequence; same for both SEQRES and ATOM records:

>d2ofbb1 b.61.1.1 (B:204-321) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
csltgkwtnnlgsimtiravnsrgeftgtyltavadnpgnitlspllgiqhkrasqptfg
ftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwkatlvgynnftrl

Timeline for d2ofbb1:

• d2ofbb1 first appeared in SCOPe 2.01, called d2ofbb_
  
• d2ofbb1 appears in SCOPe 2.07