SCOPe 2.05: Domain d2ofab_: 2ofa B:

Lineage for d2ofab_ (2ofa B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [186931] (25 PDB entries)

8. Domain d2ofab_: 2ofa B: [166671]
   automated match to d1rava_
   complexed with fmt

Details for d2ofab_

PDB Entry: 2ofa, 1.5 Å

PDB Description: crystal structure of apo avr4 (r112l,c122s)

PDB Compounds: (B:) Avidin-related protein 4/5

SCOPe Domain Sequences for d2ofab_:

Sequence; same for both SEQRES and ATOM records:

>d2ofab_ b.61.1.1 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
csltgkwtnnlgsimtiravnsrgeftgtyltavadnpgnitlspllgiqhkrasqptfg
ftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwkatlvgynnftrls

Timeline for d2ofab_:

• d2ofab_ first appeared in SCOPe 2.01
  
• d2ofab_ appears in SCOPe 2.04
  
• d2ofab_ is called d2ofab1 in SCOPe 2.06
  
• d2ofab_ appears in the current release, SCOPe 2.08, called d2ofab1