SCOPe 2.07: Domain d2ofaa1: 2ofa A:3-121

Lineage for d2ofaa1 (2ofa A:3-121)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [186931] (28 PDB entries)

8. Domain d2ofaa1: 2ofa A:3-121 [166670]
   Other proteins in same PDB: d2ofaa2, d2ofab2
   automated match to d1rava_
   complexed with fmt

Details for d2ofaa1

PDB Entry: 2ofa, 1.5 Å

PDB Description: crystal structure of apo avr4 (r112l,c122s)

PDB Compounds: (A:) Avidin-related protein 4/5

SCOPe Domain Sequences for d2ofaa1:

Sequence; same for both SEQRES and ATOM records:

>d2ofaa1 b.61.1.1 (A:3-121) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtnnlgsimtiravnsrgeftgtyltavadnpgnitlspllgiqhkrasqptf
gftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwkatlvgynnftrl

Timeline for d2ofaa1:

• d2ofaa1 first appeared in SCOPe 2.01, called d2ofaa_
  
• d2ofaa1 appears in SCOPe 2.06
  
• d2ofaa1 appears in the current release, SCOPe 2.08