Lineage for d1bfrr_ (1bfr R:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 151499Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 151500Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 151501Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 151551Protein Bacterioferritin (cytochrome b1) [47244] (2 species)
  7. 151552Species Escherichia coli [TaxId:562] [47245] (2 PDB entries)
  8. 151572Domain d1bfrr_: 1bfr R: [16667]

Details for d1bfrr_

PDB Entry: 1bfr (more details), 2.94 Å

PDB Description: iron storage and electron transport

SCOP Domain Sequences for d1bfrr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfrr_ a.25.1.1 (R:) Bacterioferritin (cytochrome b1) {Escherichia coli}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqireeg

SCOP Domain Coordinates for d1bfrr_:

Click to download the PDB-style file with coordinates for d1bfrr_.
(The format of our PDB-style files is described here.)

Timeline for d1bfrr_: