SCOPe 2.06: Domain d2of9a1: 2of9 A:3-121

Lineage for d2of9a1 (2of9 A:3-121)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [186931] (28 PDB entries)

8. Domain d2of9a1: 2of9 A:3-121 [166668]
   Other proteins in same PDB: d2of9a2, d2of9b2
   automated match to d1rava_
   complexed with fmt

Details for d2of9a1

PDB Entry: 2of9, 1.35 Å

PDB Description: crystal structure of apo avr4 (d39a/c122s)

PDB Compounds: (A:) Avidin-related protein 4/5

SCOPe Domain Sequences for d2of9a1:

Sequence; same for both SEQRES and ATOM records:

>d2of9a1 b.61.1.1 (A:3-121) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtnnlgsimtiravnsrgeftgtyltavaanpgnitlspllgiqhkrasqptf
gftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwkatrvgynnftrl

Timeline for d2of9a1:

• d2of9a1 first appeared in SCOPe 2.01, called d2of9a_
  
• d2of9a1 was called d2of9a_ in SCOPe 2.05
  
• d2of9a1 appears in SCOPe 2.07
  
• d2of9a1 appears in the current release, SCOPe 2.08