Lineage for d1bfrq_ (1bfr Q:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2448Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 2449Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 2450Family a.25.1.1: Ferritin [47241] (4 proteins)
  6. 2497Protein Bacterioferritin (cytochrome b1) [47244] (1 species)
  7. 2498Species Escherichia coli [TaxId:562] [47245] (2 PDB entries)
  8. 2517Domain d1bfrq_: 1bfr Q: [16666]

Details for d1bfrq_

PDB Entry: 1bfr (more details), 2.94 Å

PDB Description: iron storage and electron transport

SCOP Domain Sequences for d1bfrq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfrq_ a.25.1.1 (Q:) Bacterioferritin (cytochrome b1) {Escherichia coli}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqireeg

SCOP Domain Coordinates for d1bfrq_:

Click to download the PDB-style file with coordinates for d1bfrq_.
(The format of our PDB-style files is described here.)

Timeline for d1bfrq_: