SCOPe 2.05: Domain d2oe3b_: 2oe3 B:

Lineage for d2oe3b_ (2oe3 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (147 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187694] (13 PDB entries)

8. Domain d2oe3b_: 2oe3 B: [166657]
   automated match to d1r26a_

Details for d2oe3b_

PDB Entry: 2oe3, 1.8 Å

PDB Description: Crystal Structure of Mitochondrial Thioredoxin 3 from Saccharomyces cerevisiae (oxidized form)

PDB Compounds: (B:) Thioredoxin-3

SCOPe Domain Sequences for d2oe3b_:

Sequence; same for both SEQRES and ATOM records:

>d2oe3b_ c.47.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ytsitkltnltefrnlikqndklvidfyatwcgpckmmqphltkliqaypdvrfvkcdvd
espdiakecevtamptfvlgkdgqligkiiganptalekgikdl

Timeline for d2oe3b_:

• d2oe3b_ first appeared in SCOPe 2.01
  
• d2oe3b_ appears in SCOPe 2.04
  
• d2oe3b_ appears in SCOPe 2.06
  
• d2oe3b_ appears in the current release, SCOPe 2.08