SCOPe 2.08: Domain d2odmb_: 2odm B:

Lineage for d2odmb_ (2odm B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.6: EF2458-like [140404] (2 families)
   N-terminal helix swapped dimer; interrupted antiparallel coiled coil

5. Family a.23.6.0: automated matches [191550] (1 protein)
   not a true family

6. Protein automated matches [190950] (1 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:196620] [188547] (1 PDB entry)

8. Domain d2odmb_: 2odm B: [166651]
   automated match to d2gboa1

Details for d2odmb_

PDB Entry: 2odm, 2.24 Å

PDB Description: Crystal structure of S. aureus YlaN, an essential leucine rich protein involved in the control of cell shape

PDB Compounds: (B:) UPF0358 protein MW0995

SCOPe Domain Sequences for d2odmb_:

Sequence, based on SEQRES records:

>d2odmb_ a.23.6.0 (B:) automated matches {Staphylococcus aureus [TaxId: 196620]}
qatmknaalkqltkdadeilhlikvqldnltlpscplyeevldtqmfglqkevdfavklg
lvdredgkqimlrlekelsklheaftlv

Sequence, based on observed residues (ATOM records):

>d2odmb_ a.23.6.0 (B:) automated matches {Staphylococcus aureus [TaxId: 196620]}
qatmknaalkqltkdadeilhlikvqldncplyeevldtqmfglqkevdfavklglvdre
dgkqimlrlekelsklheaftlv

Timeline for d2odmb_:

• d2odmb_ first appeared in SCOPe 2.01
  
• d2odmb_ appears in SCOPe 2.07