| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) ![]() |
| Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins) |
| Protein automated matches [190756] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187954] (3 PDB entries) |
| Domain d2oded_: 2ode D: [166649] automated match to d2ik8b1 complexed with alf, gdp, mg |
PDB Entry: 2ode (more details), 1.9 Å
SCOPe Domain Sequences for d2oded_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oded_ a.91.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sfdvllshkygvaafraflktefseenlefwlaceefkktrstaklvskahrifeefvdv
qaprevnidfqtreatrknlqepsltcfdqaqgkvhslmekdsyprflrskmyldl
Timeline for d2oded_: