SCOPe 2.02: Domain d2odba_: 2odb A:

Lineage for d2odba_ (2odb A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein CDC42 [52619] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52620] (27 PDB entries)

8. Domain d2odba_: 2odb A: [166647]
   automated match to d1grna_
   complexed with cl, gcp, mg, so4

Details for d2odba_

PDB Entry: 2odb, 2.4 Å

PDB Description: the crystal structure of human cdc42 in complex with the crib domain of human p21-activated kinase 6 (pak6)

PDB Compounds: (A:) Human Cell Division Cycle 42 (CDC42)

SCOPe Domain Sequences for d2odba_:

Sequence; same for both SEQRES and ATOM records:

>d2odba_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
qtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtagq
edydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlrd
dpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale

Timeline for d2odba_:

• d2odba_ first appeared in SCOPe 2.01
  
• d2odba_ appears in SCOPe 2.03
  
• d2odba_ appears in the current release, SCOPe 2.08