SCOPe 2.05: Domain d2octb_: 2oct B:

Lineage for d2octb_ (2oct B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.2: Cystatins [54407] (7 proteins)
   automatically mapped to Pfam PF00031

6. Protein automated matches [190165] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187953] (2 PDB entries)

8. Domain d2octb_: 2oct B: [166646]
   automated match to d1stfi_

Details for d2octb_

PDB Entry: 2oct, 1.4 Å

PDB Description: stefin b (cystatin b) tetramer

PDB Compounds: (B:) Cystatin B

SCOPe Domain Sequences for d2octb_:

Sequence; same for both SEQRES and ATOM records:

>d2octb_ d.17.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gapsatqpataetqhiadqvrsqleekynkkfpvfkavsfksqvvagtnyfikvhvgded
fvhlrvfqslphenksltlsnyqtnkakhdeltyf

Timeline for d2octb_:

• d2octb_ first appeared in SCOPe 2.01
  
• d2octb_ appears in SCOPe 2.04
  
• d2octb_ appears in SCOPe 2.06
  
• d2octb_ appears in the current release, SCOPe 2.08