Lineage for d2ocha_ (2och A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2302754Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2302877Superfamily a.2.3: Chaperone J-domain [46565] (2 families) (S)
  5. 2302913Family a.2.3.0: automated matches [191473] (1 protein)
    not a true family
  6. 2302914Protein automated matches [190750] (7 species)
    not a true protein
  7. 2302936Species Nematode (Caenorhabditis elegans) [TaxId:6239] [187952] (1 PDB entry)
  8. 2302937Domain d2ocha_: 2och A: [166642]
    automated match to d1hdja_

Details for d2ocha_

PDB Entry: 2och (more details), 1.86 Å

PDB Description: J-domain of dnj-12 from Caenorhabditis elegans
PDB Compounds: (A:) Hypothetical protein dnj-12

SCOPe Domain Sequences for d2ocha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ocha_ a.2.3.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
ketgyydvlgvkpdasdnelkkayrkmalkfhpdknpdgaeqfkqisqayevlsdekkrq
iydqgg

SCOPe Domain Coordinates for d2ocha_:

Click to download the PDB-style file with coordinates for d2ocha_.
(The format of our PDB-style files is described here.)

Timeline for d2ocha_: