Lineage for d2obxd_ (2obx D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1836882Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 1836883Superfamily c.16.1: Lumazine synthase [52121] (2 families) (S)
  5. 1836884Family c.16.1.1: Lumazine synthase [52122] (2 proteins)
  6. 1837043Protein automated matches [190461] (5 species)
    not a true protein
  7. 1837077Species Mesorhizobium loti [TaxId:381] [187950] (1 PDB entry)
  8. 1837081Domain d2obxd_: 2obx D: [166632]
    automated match to d1di0a_
    complexed with ini, po4

Details for d2obxd_

PDB Entry: 2obx (more details), 2.53 Å

PDB Description: lumazine synthase ribh2 from mesorhizobium loti (gene mll7281, swiss- prot entry q986n2) complexed with inhibitor 5-nitro-6-(d- ribitylamino)-2,4(1h,3h) pyrimidinedione
PDB Compounds: (D:) 6,7-dimethyl-8-ribityllumazine synthase 1

SCOPe Domain Sequences for d2obxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2obxd_ c.16.1.1 (D:) automated matches {Mesorhizobium loti [TaxId: 381]}
etvriavvrarwhadivdqcvsafeaemadiggdrfavdvfdvpgayeiplhartlaetg
rygavlgtafvvnggiyrhefvasavidgmmnvqlstgvpvlsavltphnyhdsaehhrf
ffehftvkgkeaaracveilaareki

SCOPe Domain Coordinates for d2obxd_:

Click to download the PDB-style file with coordinates for d2obxd_.
(The format of our PDB-style files is described here.)

Timeline for d2obxd_: