SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2obxc_ (2obx C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2100750Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2100751Superfamily c.16.1: Lumazine synthase [52121] (2 families) (S)
  5. 2100752Family c.16.1.1: Lumazine synthase [52122] (2 protein domains)
  6. 2100911Protein automated matches [190461] (5 species)
    not a true protein
  7. 2100955Species Mesorhizobium loti [TaxId:381] [187950] (1 PDB entry)
  8. 2100958Domain d2obxc_: 2obx C: [166631]
    automated match to d1di0a_
    complexed with ini, po4

Details for d2obxc_

PDB Entry: 2obx (more details), 2.53 Å

PDB Description: Lumazine synthase RibH2 from Mesorhizobium loti (Gene mll7281, Swiss-Prot entry Q986N2) complexed with inhibitor 5-Nitro-6-(D-Ribitylamino)-2,4(1H,3H) Pyrimidinedione
PDB Compounds: (C:) 6,7-dimethyl-8-ribityllumazine synthase 1

SCOPe Domain Sequences for d2obxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2obxc_ c.16.1.1 (C:) automated matches {Mesorhizobium loti [TaxId: 381]}
etvriavvrarwhadivdqcvsafeaemadiggdrfavdvfdvpgayeiplhartlaetg
rygavlgtafvvnggiyrhefvasavidgmmnvqlstgvpvlsavltphnyhdsaehhrf
ffehftvkgkeaaracveilaarekia

SCOPe Domain Coordinates for d2obxc_:

Click to download the PDB-style file with coordinates for d2obxc_.
(The format of our PDB-style files is described here.)

Timeline for d2obxc_: