Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.16: Lumazine synthase [52120] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.16.1: Lumazine synthase [52121] (2 families) |
Family c.16.1.1: Lumazine synthase [52122] (2 proteins) |
Protein automated matches [190461] (5 species) not a true protein |
Species Mesorhizobium loti [TaxId:381] [187950] (1 PDB entry) |
Domain d2obxc_: 2obx C: [166631] automated match to d1di0a_ complexed with ini, po4 |
PDB Entry: 2obx (more details), 2.53 Å
SCOPe Domain Sequences for d2obxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2obxc_ c.16.1.1 (C:) automated matches {Mesorhizobium loti [TaxId: 381]} etvriavvrarwhadivdqcvsafeaemadiggdrfavdvfdvpgayeiplhartlaetg rygavlgtafvvnggiyrhefvasavidgmmnvqlstgvpvlsavltphnyhdsaehhrf ffehftvkgkeaaracveilaarekia
Timeline for d2obxc_: