Lineage for d2obxc_ (2obx C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2854558Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2854559Superfamily c.16.1: Lumazine synthase [52121] (2 families) (S)
  5. 2854560Family c.16.1.1: Lumazine synthase [52122] (2 proteins)
  6. 2854719Protein automated matches [190461] (5 species)
    not a true protein
  7. 2854763Species Mesorhizobium loti [TaxId:381] [187950] (1 PDB entry)
  8. 2854766Domain d2obxc_: 2obx C: [166631]
    automated match to d1di0a_
    complexed with ini, po4

Details for d2obxc_

PDB Entry: 2obx (more details), 2.53 Å

PDB Description: lumazine synthase ribh2 from mesorhizobium loti (gene mll7281, swiss- prot entry q986n2) complexed with inhibitor 5-nitro-6-(d- ribitylamino)-2,4(1h,3h) pyrimidinedione
PDB Compounds: (C:) 6,7-dimethyl-8-ribityllumazine synthase 1

SCOPe Domain Sequences for d2obxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2obxc_ c.16.1.1 (C:) automated matches {Mesorhizobium loti [TaxId: 381]}
etvriavvrarwhadivdqcvsafeaemadiggdrfavdvfdvpgayeiplhartlaetg
rygavlgtafvvnggiyrhefvasavidgmmnvqlstgvpvlsavltphnyhdsaehhrf
ffehftvkgkeaaracveilaarekia

SCOPe Domain Coordinates for d2obxc_:

Click to download the PDB-style file with coordinates for d2obxc_.
(The format of our PDB-style files is described here.)

Timeline for d2obxc_: