Lineage for d1bfrn_ (1bfr N:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 536008Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 536009Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 536010Family a.25.1.1: Ferritin [47241] (7 proteins)
  6. 536063Protein Bacterioferritin (cytochrome b1) [47244] (3 species)
    binds heme between two subunits; 24-mer
  7. 536113Species Escherichia coli [TaxId:562] [47245] (2 PDB entries)
  8. 536129Domain d1bfrn_: 1bfr N: [16663]

Details for d1bfrn_

PDB Entry: 1bfr (more details), 2.94 Å

PDB Description: iron storage and electron transport

SCOP Domain Sequences for d1bfrn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfrn_ a.25.1.1 (N:) Bacterioferritin (cytochrome b1) {Escherichia coli}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqireeg

SCOP Domain Coordinates for d1bfrn_:

Click to download the PDB-style file with coordinates for d1bfrn_.
(The format of our PDB-style files is described here.)

Timeline for d1bfrn_: