| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.23: Selenoprotein W-related [142411] (4 proteins) Pfam PF05169; "minimalized" version of the thioredoxin-like fold |
| Protein automated matches [190755] (4 species) not a true protein |
| Species Pseudomonas fluorescens [TaxId:220664] [187951] (1 PDB entry) |
| Domain d2obkh_: 2obk H: [166628] automated match to d2fa8a1 |
PDB Entry: 2obk (more details), 2.7 Å
SCOPe Domain Sequences for d2obkh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2obkh_ c.47.1.23 (H:) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
kpeviityctqcqwllraawlaqellstfsddlgkvslepatggafritcdgvqiwerka
dggfpeakvlkqrvrdqidperd
Timeline for d2obkh_: