Lineage for d2obkh_ (2obk H:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878927Family c.47.1.23: Selenoprotein W-related [142411] (4 proteins)
    Pfam PF05169; "minimalized" version of the thioredoxin-like fold
  6. 2878940Protein automated matches [190755] (4 species)
    not a true protein
  7. 2878949Species Pseudomonas fluorescens [TaxId:220664] [187951] (1 PDB entry)
  8. 2878957Domain d2obkh_: 2obk H: [166628]
    automated match to d2fa8a1

Details for d2obkh_

PDB Entry: 2obk (more details), 2.7 Å

PDB Description: X-Ray structure of the putative Se binding protein from Pseudomonas fluorescens. Northeast Structural Genomics Consortium target PlR6.
PDB Compounds: (H:) SelT/selW/selH selenoprotein domain

SCOPe Domain Sequences for d2obkh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2obkh_ c.47.1.23 (H:) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
kpeviityctqcqwllraawlaqellstfsddlgkvslepatggafritcdgvqiwerka
dggfpeakvlkqrvrdqidperd

SCOPe Domain Coordinates for d2obkh_:

Click to download the PDB-style file with coordinates for d2obkh_.
(The format of our PDB-style files is described here.)

Timeline for d2obkh_: