SCOPe 2.01: Domain d2obkg_: 2obk G:

Lineage for d2obkg_ (2obk G:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.23: Selenoprotein W-related [142411] (4 proteins)
   Pfam PF05169; "minimalized" version of the thioredoxin-like fold

6. Protein automated matches [190755] (4 species)
   not a true protein

7. Species Pseudomonas fluorescens [TaxId:220664] [187951] (1 PDB entry)

8. Domain d2obkg_: 2obk G: [166627]
   automated match to d2fa8a1

Details for d2obkg_

PDB Entry: 2obk, 2.7 Å

PDB Description: X-Ray structure of the putative Se binding protein from Pseudomonas fluorescens. Northeast Structural Genomics Consortium target PlR6.

PDB Compounds: (G:) SelT/selW/selH selenoprotein domain

SCOPe Domain Sequences for d2obkg_:

Sequence; same for both SEQRES and ATOM records:

>d2obkg_ c.47.1.23 (G:) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
rkpeviityctqcqwllraawlaqellstfsddlgkvslepatggafritcdgvqiwerk
adggfpeakvlkqrvrdqidperd

Timeline for d2obkg_:

• d2obkg_ is new in SCOPe 2.01-stable
  
• d2obkg_ appears in SCOPe 2.02
  
• d2obkg_ appears in the current release, SCOPe 2.08