SCOP 1.57: Domain d1bfrl_: 1bfr L:

Lineage for d1bfrl_ (1bfr L:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.25: Ferritin-like [47239] (1 superfamily)

4. Superfamily a.25.1: Ferritin-like [47240] (2 families)

5. Family a.25.1.1: Ferritin [47241] (5 proteins)

6. Protein Bacterioferritin (cytochrome b1) [47244] (1 species)

7. Species Escherichia coli [TaxId:562] [47245] (2 PDB entries)

8. Domain d1bfrl_: 1bfr L: [16661]

Details for d1bfrl_

PDB Entry: 1bfr, 2.94 Å

PDB Description: iron storage and electron transport

SCOP Domain Sequences for d1bfrl_:

Sequence; same for both SEQRES and ATOM records:

>d1bfrl_ a.25.1.1 (L:) Bacterioferritin (cytochrome b1) {Escherichia coli}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqireeg

Timeline for d1bfrl_:

• d1bfrl_ first appeared (with stable ids) in SCOP 1.55
  
• d1bfrl_ appears in SCOP 1.59
  
• d1bfrl_ appears in the current release, SCOPe 2.08