SCOPe 2.07: Domain d2oa6d_: 2oa6 D:

Lineage for d2oa6d_ (2oa6 D:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.4: Aristolochene/pentalenene synthase [48586] (3 proteins)

6. Protein automated matches [190618] (1 species)
   not a true protein

7. Species Aspergillus terreus [TaxId:33178] [187650] (16 PDB entries)

8. Domain d2oa6d_: 2oa6 D: [166602]
   automated match to d1dgpa_
   complexed with bme, gol, mg, pop

Details for d2oa6d_

PDB Entry: 2oa6, 2.15 Å

PDB Description: Aristolochene synthase from Aspergillus terreus complexed with pyrophosphate

PDB Compounds: (D:) Aristolochene synthase

SCOPe Domain Sequences for d2oa6d_:

Sequence; same for both SEQRES and ATOM records:

>d2oa6d_ a.128.1.4 (D:) automated matches {Aspergillus terreus [TaxId: 33178]}
slepppstfqplchplveevskevdgyflqhwnfpnekarkkfvaagfsrvtclyfpkal
ddrihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdrsipveyiiydlw
esmrahdremadeilepvflfmraqtdrtrarpmglggyleyrerdvgkellaalmrfsm
glklspselqrvreidancskhlsvvndiysyekelytsktahseggilctsvqilaqea
dvtaeaakrvlfvmcrewelrhqllvarlsaegletpglaayvegleyqmsgnelwsqtt
lrysvv

Timeline for d2oa6d_:

• d2oa6d_ first appeared in SCOPe 2.01
  
• d2oa6d_ appears in SCOPe 2.06
  
• d2oa6d_ appears in the current release, SCOPe 2.08