Lineage for d2oa6d_ (2oa6 D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2344488Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2344489Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2344799Family a.128.1.4: Aristolochene/pentalenene synthase [48586] (3 proteins)
  6. 2344830Protein automated matches [190618] (1 species)
    not a true protein
  7. 2344831Species Aspergillus terreus [TaxId:33178] [187650] (16 PDB entries)
  8. 2344863Domain d2oa6d_: 2oa6 D: [166602]
    automated match to d1dgpa_
    complexed with bme, gol, mg, pop

Details for d2oa6d_

PDB Entry: 2oa6 (more details), 2.15 Å

PDB Description: Aristolochene synthase from Aspergillus terreus complexed with pyrophosphate
PDB Compounds: (D:) Aristolochene synthase

SCOPe Domain Sequences for d2oa6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oa6d_ a.128.1.4 (D:) automated matches {Aspergillus terreus [TaxId: 33178]}
slepppstfqplchplveevskevdgyflqhwnfpnekarkkfvaagfsrvtclyfpkal
ddrihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdrsipveyiiydlw
esmrahdremadeilepvflfmraqtdrtrarpmglggyleyrerdvgkellaalmrfsm
glklspselqrvreidancskhlsvvndiysyekelytsktahseggilctsvqilaqea
dvtaeaakrvlfvmcrewelrhqllvarlsaegletpglaayvegleyqmsgnelwsqtt
lrysvv

SCOPe Domain Coordinates for d2oa6d_:

Click to download the PDB-style file with coordinates for d2oa6d_.
(The format of our PDB-style files is described here.)

Timeline for d2oa6d_: