Lineage for d2o9ka_ (2o9k A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2808917Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2809156Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2809157Protein automated matches [190568] (11 species)
    not a true protein
  7. 2809207Species Human (Homo sapiens) [TaxId:9606] [187559] (94 PDB entries)
  8. 2809241Domain d2o9ka_: 2o9k A: [166592]
    automated match to d1vyhc1

Details for d2o9ka_

PDB Entry: 2o9k (more details), 1.9 Å

PDB Description: WDR5 in Complex with Dimethylated H3K4 Peptide
PDB Compounds: (A:) WD repeat protein 5

SCOPe Domain Sequences for d2o9ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o9ka_ b.69.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghklgi
sdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgsfd
esvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclktli
dddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsvtg
gkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktiklw
ksdc

SCOPe Domain Coordinates for d2o9ka_:

Click to download the PDB-style file with coordinates for d2o9ka_.
(The format of our PDB-style files is described here.)

Timeline for d2o9ka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2o9kc_