Lineage for d2o9ia_ (2o9i A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923257Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 923258Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 923259Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 923798Protein Pregnane x receptor, PXR [63624] (1 species)
  7. 923799Species Human (Homo sapiens) [TaxId:9606] [63625] (7 PDB entries)
  8. 923806Domain d2o9ia_: 2o9i A: [166590]
    automated match to d1m13a_
    complexed with 444

Details for d2o9ia_

PDB Entry: 2o9i (more details), 2.8 Å

PDB Description: Crystal Structure of the Human Pregnane X Receptor LBD in complex with an SRC-1 coactivator peptide and T0901317
PDB Compounds: (A:) orphan nuclear receptor pxr

SCOPe Domain Sequences for d2o9ia_:

Sequence, based on SEQRES records: (download)

>d2o9ia_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]}
glteeqrmmirelmdaqmktfdttfshfknfrlpgvlssgcelpeslqapsreeaakwsq
vrkdlcslkvslqlrgedgsvwnykppadsggkeifsllphmadmstymfkgiisfakvi
syfrdlpiedqisllkgaafelsqlrfntvfnaetgtwecgrlsycledtaggfqqllle
pmlkfhymlkklqlheeeyvlmqaislfspdrpgvlqhrvvdqlqeqfaitlksyiecnr
pqpahrflflkimamltelrsinaqhtqrllriqdihpfatplmqelfgitg

Sequence, based on observed residues (ATOM records): (download)

>d2o9ia_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]}
glteeqrmmirelmdaqmktfdttfshfknfrlpgvlsreeaakwsqvrkdlcslkvslq
lrgedgsvwnykppadsggkeifsllphmadmstymfkgiisfakvisyfrdlpiedqis
llkgaafelsqlrfntvfnaetgtwecgrlsycledtaggfqqlllepmlkfhymlkklq
lheeeyvlmqaislfspdrpgvlqhrvvdqlqeqfaitlksyiecnrpqpahrflflkim
amltelrsinaqhtqrllriqdihpfatplmqelfgitg

SCOPe Domain Coordinates for d2o9ia_:

Click to download the PDB-style file with coordinates for d2o9ia_.
(The format of our PDB-style files is described here.)

Timeline for d2o9ia_: