| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
| Protein Thioredoxin [52835] (16 species) |
| Species Staphylococcus aureus [TaxId:1280] [187358] (5 PDB entries) |
| Domain d2o85a_: 2o85 A: [166581] automated match to d1nswa_ mutant |
PDB Entry: 2o85 (more details), 2.2 Å
SCOPe Domain Sequences for d2o85a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o85a_ c.47.1.1 (A:) Thioredoxin {Staphylococcus aureus [TaxId: 1280]}
aivkvtdadfdskvesgvqlvdfwatwcgtckmiapvleelaadyegkadilkldvdenp
staakyevmsiptlivfkdgqpvdkvvgfqpkenlaevldkhl
Timeline for d2o85a_: