Lineage for d2o7ud_ (2o7u D:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008597Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1008598Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1009393Family c.94.1.2: Transferrin [53888] (4 proteins)
    further duplication: composed of two two-domain lobes
  6. 1009564Protein automated matches [190754] (1 species)
    not a true protein
  7. 1009565Species Human (Homo sapiens) [TaxId:9606] [187949] (2 PDB entries)
  8. 1009570Domain d2o7ud_: 2o7u D: [166574]
    automated match to d1bp5c_
    complexed with co3, fe; mutant

Details for d2o7ud_

PDB Entry: 2o7u (more details), 2.8 Å

PDB Description: crystal structure of k206e/k296e mutant of the n-terminal half molecule of human transferrin
PDB Compounds: (D:) serotransferrin

SCOPe Domain Sequences for d2o7ud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o7ud_ c.94.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtl
daglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtgl
grsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstl
nqyfgysgafkclkdgagdvafvehstifenlankadrdqyellcldntrkpvdeykdch
laqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfedsahgf
lkvpprmdakmylgyeyvtairnlregtc

SCOPe Domain Coordinates for d2o7ud_:

Click to download the PDB-style file with coordinates for d2o7ud_.
(The format of our PDB-style files is described here.)

Timeline for d2o7ud_: