Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.2: Transferrin [53888] (4 proteins) further duplication: composed of two two-domain lobes |
Protein automated matches [190754] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187949] (2 PDB entries) |
Domain d2o7ua_: 2o7u A: [166571] automated match to d1bp5c_ complexed with co3, fe; mutant |
PDB Entry: 2o7u (more details), 2.8 Å
SCOPe Domain Sequences for d2o7ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o7ua_ c.94.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtl daglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtgl grsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstl nqyfgysgafkclkdgagdvafvehstifenlankadrdqyellcldntrkpvdeykdch laqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfedsahgf lkvpprmdakmylgyeyvtairnlregtc
Timeline for d2o7ua_: