Lineage for d1bfrh_ (1bfr H:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1989404Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1989629Protein Bacterioferritin (cytochrome b1) [47244] (6 species)
    binds heme between two subunits; 24-mer
  7. 1989757Species Escherichia coli [TaxId:562] [47245] (11 PDB entries)
  8. 1989857Domain d1bfrh_: 1bfr H: [16657]
    complexed with hem, mn

Details for d1bfrh_

PDB Entry: 1bfr (more details), 2.94 Å

PDB Description: iron storage and electron transport
PDB Compounds: (H:) bacterioferritin

SCOPe Domain Sequences for d1bfrh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfrh_ a.25.1.1 (H:) Bacterioferritin (cytochrome b1) {Escherichia coli [TaxId: 562]}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqireeg

SCOPe Domain Coordinates for d1bfrh_:

Click to download the PDB-style file with coordinates for d1bfrh_.
(The format of our PDB-style files is described here.)

Timeline for d1bfrh_: