Lineage for d1bfrh_ (1bfr H:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46712Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 46713Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 46714Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 46763Protein Bacterioferritin (cytochrome b1) [47244] (1 species)
  7. 46764Species Escherichia coli [TaxId:562] [47245] (2 PDB entries)
  8. 46774Domain d1bfrh_: 1bfr H: [16657]

Details for d1bfrh_

PDB Entry: 1bfr (more details), 2.94 Å

PDB Description: iron storage and electron transport

SCOP Domain Sequences for d1bfrh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfrh_ a.25.1.1 (H:) Bacterioferritin (cytochrome b1) {Escherichia coli}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqireeg

SCOP Domain Coordinates for d1bfrh_:

Click to download the PDB-style file with coordinates for d1bfrh_.
(The format of our PDB-style files is described here.)

Timeline for d1bfrh_: