Lineage for d2o6xa_ (2o6x A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155423Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2155424Protein automated matches [190230] (20 species)
    not a true protein
  7. 2155436Species Fasciola hepatica [TaxId:6192] [188299] (1 PDB entry)
  8. 2155437Domain d2o6xa_: 2o6x A: [166568]
    automated match to d1by8a_

Details for d2o6xa_

PDB Entry: 2o6x (more details), 1.4 Å

PDB Description: crystal structure of procathepsin l1 from fasciola hepatica
PDB Compounds: (A:) Secreted cathepsin L 1

SCOPe Domain Sequences for d2o6xa_:

Sequence, based on SEQRES records: (download)

>d2o6xa_ d.3.1.0 (A:) automated matches {Fasciola hepatica [TaxId: 6192]}
nddlwhqwkrmynkeyngaddqhrrniweknvkhiqehnlrhdlglvtytlglnqftdmt
feefkakyltemsrasdilshgvpyeannravpdkidwresgyvtevkdqgncgsgwafs
ttgtmegqymknertsisfseqqlvdcsrpwgnngcggglmenayqylkqfgletessyp
ytavegqcrynkqlgvakvtgfytvhsgsevelknlvgaegpaavavdvesdfmmyrsgi
yqsqtcsplrvnhavlavgygtqggtdywivknswglswgergyirmvrnrgnmcgiasl
aslpmvarfp

Sequence, based on observed residues (ATOM records): (download)

>d2o6xa_ d.3.1.0 (A:) automated matches {Fasciola hepatica [TaxId: 6192]}
nddlwhqwkrmynkeyngaddqhrrniweknvkhiqehnlrhdlglvtytlglnqftdmt
feefkakyltemsrasdilshgvpyeavpdkidwresgyvtevkdqgncgsgwafsttgt
megqymknertsisfseqqlvdcsrpwgnngcggglmenayqylkqfgletessypytav
egqcrynkqlgvakvtgfytvhsgsevelknlvgaegpaavavdvesdfmmyrsgiyqsq
tcsplrvnhavlavgygtqggtdywivknswglswgergyirmvrnrgnmcgiaslaslp
mvarfp

SCOPe Domain Coordinates for d2o6xa_:

Click to download the PDB-style file with coordinates for d2o6xa_.
(The format of our PDB-style files is described here.)

Timeline for d2o6xa_: