SCOPe 2.08: Domain d2o6ma_: 2o6m A:

Lineage for d2o6ma_ (2o6m A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
   core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures

4. Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families)
   common motif contains conserved histidine residue and metal-binding site

5. Family d.4.1.3: Intron-encoded homing endonucleases [54069] (2 proteins)

6. Protein Intron-encoded homing endonuclease I-PpoI [54070] (1 species)

7. Species Slime mold (Physarum polycephalum) [TaxId:5791] [54071] (8 PDB entries)

8. Domain d2o6ma_: 2o6m A: [166566]
   automated match to d1cyqa_
   protein/DNA complex; complexed with mg, zn; mutant

Details for d2o6ma_

PDB Entry: 2o6m, 2.3 Å

PDB Description: h98q mutant of the homing endonuclease i-ppoi complexed with dna

PDB Compounds: (A:) intron-encoded endonuclease I-ppoi

SCOPe Domain Sequences for d2o6ma_:

Sequence; same for both SEQRES and ATOM records:

>d2o6ma_ d.4.1.3 (A:) Intron-encoded homing endonuclease I-PpoI {Slime mold (Physarum polycephalum) [TaxId: 5791]}
altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
wqykrtinqvvhrwgshtvpfllepdningktctasqlchntrchnplhlcweslddnkg
rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv

Timeline for d2o6ma_:

• d2o6ma_ first appeared in SCOPe 2.01
  
• d2o6ma_ appears in SCOPe 2.07