Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
Protein automated matches [190753] (4 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187948] (3 PDB entries) |
Domain d2o67a_: 2o67 A: [166560] automated match to d1qy7a_ complexed with mli |
PDB Entry: 2o67 (more details), 2.5 Å
SCOPe Domain Sequences for d2o67a_:
Sequence, based on SEQRES records: (download)
>d2o67a_ d.58.5.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ssdyipdskfykveaivrpwriqqvssallkigirgvtvsdvrgfgaqggsterhggsef sedkfvakvkmeivvkkdqvesvintiiegartgeigdgkifvlpvsdvirvrtgergek
>d2o67a_ d.58.5.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ssdyipdskfykveaivrpwriqqvssallkigirgvtvsdvrgfgedkfvakvkmeivv kkdqvesvintiiegartgeigdgkifvlpvsdvirvrtgergek
Timeline for d2o67a_: