Lineage for d2o67a_ (2o67 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1027295Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 1027514Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 1027515Protein automated matches [190753] (4 species)
    not a true protein
  7. 1027557Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187948] (3 PDB entries)
  8. 1027563Domain d2o67a_: 2o67 A: [166560]
    automated match to d1qy7a_
    complexed with mli

Details for d2o67a_

PDB Entry: 2o67 (more details), 2.5 Å

PDB Description: Crystal structure of Arabidopsis thaliana PII bound to malonate
PDB Compounds: (A:) pii protein

SCOPe Domain Sequences for d2o67a_:

Sequence, based on SEQRES records: (download)

>d2o67a_ d.58.5.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ssdyipdskfykveaivrpwriqqvssallkigirgvtvsdvrgfgaqggsterhggsef
sedkfvakvkmeivvkkdqvesvintiiegartgeigdgkifvlpvsdvirvrtgergek

Sequence, based on observed residues (ATOM records): (download)

>d2o67a_ d.58.5.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ssdyipdskfykveaivrpwriqqvssallkigirgvtvsdvrgfgedkfvakvkmeivv
kkdqvesvintiiegartgeigdgkifvlpvsdvirvrtgergek

SCOPe Domain Coordinates for d2o67a_:

Click to download the PDB-style file with coordinates for d2o67a_.
(The format of our PDB-style files is described here.)

Timeline for d2o67a_: