Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) |
Family b.34.9.1: Tudor domain [63749] (8 proteins) Pfam PF00567 |
Protein automated matches [190752] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187947] (1 PDB entry) |
Domain d2o4xb_: 2o4x B: [166549] automated match to d2hqxa1 |
PDB Entry: 2o4x (more details), 2 Å
SCOPe Domain Sequences for d2o4xb_:
Sequence, based on SEQRES records: (download)
>d2o4xb_ b.34.9.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tqfeklmenmrndiashppvegsyaprrgefciakfvdgewyrarvekvespakihvfyi dygnrevlpstrlgtlspafstrvlpaqate
>d2o4xb_ b.34.9.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tqfeklmenmrndiashppyaprrgefciakfvdgewyrarvekvespakihvfyidygn revlpstrlgtlspafstrvlpaqate
Timeline for d2o4xb_: