SCOPe 2.01: Domain d2o4xb_: 2o4x B:

Lineage for d2o4xb_ (2o4x B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.1: Tudor domain [63749] (8 proteins)
   Pfam PF00567

6. Protein automated matches [190752] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187947] (1 PDB entry)

8. Domain d2o4xb_: 2o4x B: [166549]
   automated match to d2hqxa1

Details for d2o4xb_

PDB Entry: 2o4x, 2 Å

PDB Description: Crystal structure of human P100 tudor domain

PDB Compounds: (B:) Staphylococcal nuclease domain-containing protein 1

SCOPe Domain Sequences for d2o4xb_:

Sequence, based on SEQRES records:

>d2o4xb_ b.34.9.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqfeklmenmrndiashppvegsyaprrgefciakfvdgewyrarvekvespakihvfyi
dygnrevlpstrlgtlspafstrvlpaqate

Sequence, based on observed residues (ATOM records):

>d2o4xb_ b.34.9.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqfeklmenmrndiashppyaprrgefciakfvdgewyrarvekvespakihvfyidygn
revlpstrlgtlspafstrvlpaqate

Timeline for d2o4xb_:

• d2o4xb_ is new in SCOPe 2.01-stable
  
• d2o4xb_ appears in SCOPe 2.02
  
• d2o4xb_ appears in the current release, SCOPe 2.08