Lineage for d2o4qp_ (2o4q P:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2442004Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2442120Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
    automatically mapped to Pfam PF02126
  6. 2442121Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (5 species)
  7. 2442157Species Pseudomonas diminuta [TaxId:293] [51566] (41 PDB entries)
    Uniprot P0A434 30-365
  8. 2442225Domain d2o4qp_: 2o4q P: [166547]
    automated match to d1i0bb_
    complexed with cac, zn; mutant

Details for d2o4qp_

PDB Entry: 2o4q (more details), 1.95 Å

PDB Description: structure of phosphotriesterase mutant g60a
PDB Compounds: (P:) Parathion hydrolase

SCOPe Domain Sequences for d2o4qp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o4qp_ c.1.9.3 (P:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]}
gdrintvrgpitiseagftlthehicassagflrawpeffgsrkalaekavrglrraraa
gvrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflre
iqygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqa
aifeseglspsrvcighsddtddlsyltalaargyligldhiphsaiglednasasallg
irswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafiplrvi
pflrekgvpqetlagitvtnparflsptlr

SCOPe Domain Coordinates for d2o4qp_:

Click to download the PDB-style file with coordinates for d2o4qp_.
(The format of our PDB-style files is described here.)

Timeline for d2o4qp_: