SCOPe 2.01: Domain d2o4mc_: 2o4m C:

Lineage for d2o4mc_ (2o4m C:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)

6. Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (3 species)

7. Species Pseudomonas diminuta [TaxId:293] [51566] (17 PDB entries)
   Uniprot P0A434 30-365

8. Domain d2o4mc_: 2o4m C: [166540]
   automated match to d1i0bb_
   complexed with acy, cac, gol, zn; mutant

Details for d2o4mc_

PDB Entry: 2o4m, 1.64 Å

PDB Description: structure of phosphotriesterase mutant i106g/f132g/h257y

PDB Compounds: (C:) Parathion hydrolase

SCOPe Domain Sequences for d2o4mc_:

Sequence; same for both SEQRES and ATOM records:

>d2o4mc_ c.1.9.3 (C:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]}
gdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraa
gvrtivdvstfdggrdvsllaevsraadvhivaatglwgdpplsmrlrsveeltqfflre
iqygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqa
aifeseglspsrvcighsddtddlsyltalaargyligldhipysaiglednasasallg
irswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafiplrvi
pflrekgvpqetlagitvtnparflsptlra

Timeline for d2o4mc_:

• d2o4mc_ is new in SCOPe 2.01-stable
  
• d2o4mc_ appears in SCOPe 2.02
  
• d2o4mc_ appears in the current release, SCOPe 2.08