Lineage for d1bfre_ (1bfr E:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 638518Fold a.25: Ferritin-like [47239] (4 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 638519Superfamily a.25.1: Ferritin-like [47240] (5 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 638520Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 638604Protein Bacterioferritin (cytochrome b1) [47244] (4 species)
    binds heme between two subunits; 24-mer
  7. 638679Species Escherichia coli [TaxId:562] [47245] (3 PDB entries)
  8. 638704Domain d1bfre_: 1bfr E: [16654]

Details for d1bfre_

PDB Entry: 1bfr (more details), 2.94 Å

PDB Description: iron storage and electron transport
PDB Compounds: (E:) bacterioferritin

SCOP Domain Sequences for d1bfre_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfre_ a.25.1.1 (E:) Bacterioferritin (cytochrome b1) {Escherichia coli [TaxId: 562]}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqireeg

SCOP Domain Coordinates for d1bfre_:

Click to download the PDB-style file with coordinates for d1bfre_.
(The format of our PDB-style files is described here.)

Timeline for d1bfre_: