Lineage for d1bfre_ (1bfr E:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 96482Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 96483Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 96484Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 96533Protein Bacterioferritin (cytochrome b1) [47244] (2 species)
  7. 96534Species Escherichia coli [TaxId:562] [47245] (2 PDB entries)
  8. 96541Domain d1bfre_: 1bfr E: [16654]

Details for d1bfre_

PDB Entry: 1bfr (more details), 2.94 Å

PDB Description: iron storage and electron transport

SCOP Domain Sequences for d1bfre_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfre_ a.25.1.1 (E:) Bacterioferritin (cytochrome b1) {Escherichia coli}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqireeg

SCOP Domain Coordinates for d1bfre_:

Click to download the PDB-style file with coordinates for d1bfre_.
(The format of our PDB-style files is described here.)

Timeline for d1bfre_: