Lineage for d2o4ma_ (2o4m A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 971605Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 971705Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
  6. 971706Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (3 species)
  7. 971726Species Pseudomonas diminuta [TaxId:293] [51566] (17 PDB entries)
    Uniprot P0A434 30-365
  8. 971737Domain d2o4ma_: 2o4m A: [166538]
    automated match to d1i0bb_
    complexed with acy, cac, gol, zn; mutant

Details for d2o4ma_

PDB Entry: 2o4m (more details), 1.64 Å

PDB Description: structure of phosphotriesterase mutant i106g/f132g/h257y
PDB Compounds: (A:) Parathion hydrolase

SCOPe Domain Sequences for d2o4ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o4ma_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]}
gdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraa
gvrtivdvstfdggrdvsllaevsraadvhivaatglwgdpplsmrlrsveeltqfflre
iqygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqa
aifeseglspsrvcighsddtddlsyltalaargyligldhipysaiglednasasallg
irswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafiplrvi
pflrekgvpqetlagitvtnparflsptlr

SCOPe Domain Coordinates for d2o4ma_:

Click to download the PDB-style file with coordinates for d2o4ma_.
(The format of our PDB-style files is described here.)

Timeline for d2o4ma_: