SCOPe 2.05: Domain d2o3qb_: 2o3q B:

Lineage for d2o3qb_ (2o3q B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families)
   there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members

5. Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins)
   contains extra N-terminal all-alpha subdomain
   automatically mapped to Pfam PF02267

6. Protein ADP ribosyl cyclase [56631] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159490] (38 PDB entries)
   Uniprot P28907 45-291

8. Domain d2o3qb_: 2o3q B: [166525]
   automated match to d2ef1a1
   complexed with cxr

Details for d2o3qb_

PDB Entry: 2o3q, 1.98 Å

PDB Description: structural basis for formation and hydrolysis of calcium messenger cyclic adp-ribose by human cd38

PDB Compounds: (B:) ADP-ribosyl cyclase 1

SCOPe Domain Sequences for d2o3qb_:

Sequence; same for both SEQRES and ATOM records:

>d2o3qb_ c.23.14.3 (B:) ADP ribosyl cyclase {Human (Homo sapiens) [TaxId: 9606]}
rwrqtwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcditee
dyqplmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefd
tskinyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdkdstfgs
vqvhnlqpekvqtleawvihggredsrdlcqdptikelesiiskrniqfsckniyrpdkf
lqcvknpedssc

Timeline for d2o3qb_:

• d2o3qb_ first appeared in SCOPe 2.01
  
• d2o3qb_ appears in SCOPe 2.04
  
• d2o3qb_ appears in SCOPe 2.06
  
• d2o3qb_ appears in the current release, SCOPe 2.08