SCOPe 2.05: Domain d2o3ka_: 2o3k A:

Lineage for d2o3ka_ (2o3k A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
   strand 5 is parallel to strand 4

6. Protein Cytosine deaminase [89801] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89802] (7 PDB entries)

8. Domain d2o3ka_: 2o3k A: [166521]
   automated match to d1ox7b_
   complexed with ca, hpy, zn; mutant

Details for d2o3ka_

PDB Entry: 2o3k, 2.3 Å

PDB Description: yeast cytosine deaminase d92e triple mutant bound to transition state analogue hpy

PDB Compounds: (A:) Cytosine deaminase

SCOPe Domain Sequences for d2o3ka_:

Sequence; same for both SEQRES and ATOM records:

>d2o3ka_ c.97.1.2 (A:) Cytosine deaminase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gmaskwdqkgmdiayeeallgykeggvpiggclinnkdgsvlgrghnmrfqkgsatlhge
istlencgrlegkvykdttlyttlspcemctgaiimygiprcvigenvnfkskgekylqt
rghevvvvdderckklmkqfiderpqdwfedige

Timeline for d2o3ka_:

• d2o3ka_ first appeared in SCOPe 2.01
  
• d2o3ka_ appears in SCOPe 2.04
  
• d2o3ka_ appears in SCOPe 2.06
  
• d2o3ka_ appears in the current release, SCOPe 2.08