Lineage for d2o3ha1 (2o3h A:40-318)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594378Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2594379Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2594380Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 2594440Protein automated matches [190454] (2 species)
    not a true protein
  7. 2594441Species Human (Homo sapiens) [TaxId:9606] [187368] (6 PDB entries)
  8. 2594447Domain d2o3ha1: 2o3h A:40-318 [166520]
    Other proteins in same PDB: d2o3ha2
    automated match to d1dewb_
    complexed with act, sm

Details for d2o3ha1

PDB Entry: 2o3h (more details), 1.9 Å

PDB Description: crystal structure of the human c65a ape
PDB Compounds: (A:) DNA-(apurinic or apyrimidinic site) lyase

SCOPe Domain Sequences for d2o3ha1:

Sequence, based on SEQRES records: (download)

>d2o3ha1 d.151.1.1 (A:40-318) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egpalyedppdqktspsgkpatlkiaswnvdglrawikkkgldwvkeeapdilclqetkc
senklpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrviv
aefdsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeid
lrnpkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvg
wrldyfllshsllpalcdskirskalgsdhcpitlylal

Sequence, based on observed residues (ATOM records): (download)

>d2o3ha1 d.151.1.1 (A:40-318) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egpalyedppdqktspsgkpatlkiaswnvdglrawikkkgldwvkeeapdilclqetkc
senklpaelqelpglshqywsapsegysgvgllsrqcplkvsygigdeehdqegrvivae
fdsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlr
npkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwr
ldyfllshsllpalcdskirskalgsdhcpitlylal

SCOPe Domain Coordinates for d2o3ha1:

Click to download the PDB-style file with coordinates for d2o3ha1.
(The format of our PDB-style files is described here.)

Timeline for d2o3ha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2o3ha2