Lineage for d2o3ha_ (2o3h A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676253Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 1676254Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 1676255Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 1676307Protein automated matches [190454] (2 species)
    not a true protein
  7. 1676308Species Human (Homo sapiens) [TaxId:9606] [187368] (8 PDB entries)
  8. 1676311Domain d2o3ha_: 2o3h A: [166520]
    automated match to d1dewb_
    complexed with act, sm

Details for d2o3ha_

PDB Entry: 2o3h (more details), 1.9 Å

PDB Description: crystal structure of the human c65a ape
PDB Compounds: (A:) DNA-(apurinic or apyrimidinic site) lyase

SCOPe Domain Sequences for d2o3ha_:

Sequence, based on SEQRES records: (download)

>d2o3ha_ d.151.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
masegpalyedppdqktspsgkpatlkiaswnvdglrawikkkgldwvkeeapdilclqe
tkcsenklpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegr
vivaefdsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvahe
eidlrnpkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsk
nvgwrldyfllshsllpalcdskirskalgsdhcpitlylal

Sequence, based on observed residues (ATOM records): (download)

>d2o3ha_ d.151.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
masegpalyedppdqktspsgkpatlkiaswnvdglrawikkkgldwvkeeapdilclqe
tkcsenklpaelqelpglshqywsapsegysgvgllsrqcplkvsygigdeehdqegrvi
vaefdsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheei
dlrnpkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknv
gwrldyfllshsllpalcdskirskalgsdhcpitlylal

SCOPe Domain Coordinates for d2o3ha_:

Click to download the PDB-style file with coordinates for d2o3ha_.
(The format of our PDB-style files is described here.)

Timeline for d2o3ha_: