![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.151: DNase I-like [56218] (1 superfamily) contains beta-sandwich; duplication of alpha+beta motif |
![]() | Superfamily d.151.1: DNase I-like [56219] (4 families) ![]() |
![]() | Family d.151.1.1: DNase I-like [56220] (7 proteins) |
![]() | Protein automated matches [190454] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187368] (6 PDB entries) |
![]() | Domain d2o3ha1: 2o3h A:40-318 [166520] Other proteins in same PDB: d2o3ha2 automated match to d1dewb_ complexed with act, sm |
PDB Entry: 2o3h (more details), 1.9 Å
SCOPe Domain Sequences for d2o3ha1:
Sequence, based on SEQRES records: (download)
>d2o3ha1 d.151.1.1 (A:40-318) automated matches {Human (Homo sapiens) [TaxId: 9606]} egpalyedppdqktspsgkpatlkiaswnvdglrawikkkgldwvkeeapdilclqetkc senklpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrviv aefdsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeid lrnpkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvg wrldyfllshsllpalcdskirskalgsdhcpitlylal
>d2o3ha1 d.151.1.1 (A:40-318) automated matches {Human (Homo sapiens) [TaxId: 9606]} egpalyedppdqktspsgkpatlkiaswnvdglrawikkkgldwvkeeapdilclqetkc senklpaelqelpglshqywsapsegysgvgllsrqcplkvsygigdeehdqegrvivae fdsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlr npkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwr ldyfllshsllpalcdskirskalgsdhcpitlylal
Timeline for d2o3ha1: