SCOPe 2.07: Domain d2o3cc_: 2o3c C:

Lineage for d2o3cc_ (2o3c C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.151: DNase I-like [56218] (1 superfamily)
   contains beta-sandwich; duplication of alpha+beta motif

4. Superfamily d.151.1: DNase I-like [56219] (4 families)

5. Family d.151.1.1: DNase I-like [56220] (7 proteins)

6. Protein automated matches [190454] (2 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [188298] (1 PDB entry)

8. Domain d2o3cc_: 2o3c C: [166518]
   Other proteins in same PDB: d2o3cb2
   automated match to d1dewb_
   complexed with pb

Details for d2o3cc_

PDB Entry: 2o3c, 2.3 Å

PDB Description: crystal structure of zebrafish ape

PDB Compounds: (C:) APEX nuclease 1

SCOPe Domain Sequences for d2o3cc_:

Sequence; same for both SEQRES and ATOM records:

>d2o3cc_ d.151.1.1 (C:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
pilyedppekltskdgraanmkitswnvdglrawvkkngldwvrkedpdilclqetkcae
kalpaditampeyphkywagsedkegysgvamlckteplnvtygigkeehdkegrvitae
fpdfflvtayvpnasrglvrldyrktwdvdfraylcgldarkplvlcgdlnvahqeidlk
npkgnrknagftpeeregftqlleagftdsfrelypdqayaytfwtymmnarsknvgwrl
dyfvlssallpglcdskirntamgsdhcpitlflav

Timeline for d2o3cc_:

• d2o3cc_ first appeared in SCOPe 2.01
  
• d2o3cc_ appears in SCOPe 2.06
  
• d2o3cc_ appears in the current release, SCOPe 2.08